Ensures the proper localization of the mRNA of the bicoid gene to the anterior regions of the oocyte thus playing a fundamental role in the establishment of the polarity of the oocyte. May bind the bcd mRNA (By similarity).

495 amino acids

MVAEISKDCVTIAAADQCVDMKEELPAGNYILVGVDVDTTGRRLIDEIVQLAAYTPKDNFQQYIMPYMNLNPAARQRHQIRVISIGFYRMLKSMQTYKIIKSKSEVAALMDFLNWLEMLVAKQPSTDGIVMLYHEERKFIPYMVLEALKKYGLIERFNRTVKSFVNTFNMAKASLGDANLKNCGLRKLSLLLAKSNDESANKENEPENVNRNGSSNDKCHKNGMNQEHDFFEGSANVRAKMVYEVALQLTNSDRTSEPESSEELVNLFNAVKPFAKLVSSDIMELQTQNENMGRQNSFRPVFLNYFRTTLYHRVRAVKFRIVLAENGFTLDSLKAIWTEKRKEGLELALTNIDTLKTEEKTELVELLDSFFDPSKATIKPSFKPNGNGPRRRIRANGAASSKNGAMSSRSTSTEFGAGGDKSQTEGLSAPVPDSTTKSPSPGKTGGRPHRKRNNTRNGFGSAKGPKKAETLNIAAPEPPQSPVAVSTPVAIAATN

55 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make exu1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here