About Products Protein Database Contact

Protein expression services for mtlF | Mannitol-specific phosphotransferase enzyme IIA component

Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II CmtAB PTS system is involved in D-mannitol transport.
Species
Staphylococcus aureus (strain MRSA252)
Length
144 amino acids
Sequence
MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLAIPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEEGNVDRIVQAKSAEEIKQVFEEADA
Mass
15.5 kDa
Simulated SDS-PAGE
Western blot of mtlF recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mtlF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here