Involved in the repression of the expression of the mannitol mtlADR operon. Does not bind the operator/promoter regulatory region of this operon. Therefore, seems to belong to a new class of transcription factors in bacteria that may regulate gene expression indirectly, perhaps as a part of a larger transcriptional complex.

Belongs to the MtlR/FumE family.

195 amino acids

MVDQAQDTLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNLLVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREELNHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRSTMVLSLTELISKISLKKAFQK

22 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mtlR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here