Probably part of the ABC transporter complex MntABCD involved in manganese import. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the ABC-3 integral membrane protein family.

295 amino acids

MSFEAWIIATGVLVGVSCGLIGTFLVLRSMAMLADAISHTVLLGIVGAFLVTGSLDGIYMFIGAAATGLLTAFLVQLLHSKGVQSDAAIGVVFTSLFAIGVILLSVYGANVHLDIEHSLMGEIAFVPWNTVTVFGVDIGPKAFWMLASVLVLNVVLISVCYKEFKIASFDPQMALALGIPVLLIHYVQMGMLSLTTVASFDSVGAVLVVAMLIVPPAAAHLLTDRLLYMLILSALIGGLSAVMGYFFATWLNVSISGAMAAMTGVCYASAFLFSPANGVITKKLRTLNMQKERAG

31.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mntD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here