Involved in the control of flavonoid biosynthesis in fruits, probably by binding directly to natural flavonoids (By similarity). Binds the natural flavonoid myricetin with affinities in the low micromolar range (PubMed:24133217).

Belongs to the BetVI family.

160 amino acids

MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKENFVYSYSLIEGDALSDKIEKISYETKLVSSSDGGSIIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC

17.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FRAA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here