Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod (By similarity).

126 amino acids

MAQLPPGDIATMPNQKVVFNAPFDNKATYYVRVINPGTNRIGFAFKTTKPKRINMNPPNGVLGPKESVNVAISCDAFDPSSEDTKGDRVTVEWCNTPDPAAAAFKLEWFQGDGMVRRKNLPIEYNV

13.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MSP-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here