Anchoring subunit of the major fimbriae. Regulates fimbrial length (PubMed:20530728). These filamentous pili are attached to the cell surface; they mediate biofilm formation, adhesion onto host cells and onto other bacteria that are part of the oral microbiome. Fimbriae of P.gingivalis are major virulence factors (Probable).

Belongs to the bacteroidetes fimbrillin superfamily. FimB/Mfa2 family.

303 amino acids

MNDAKKYIVSVLILLVAGMFGGCIKEDYSDCPRPFRLTVRAWDADMQDITETGAVQRVVIFVFDETGRRIDRLMMDAAQVAARKPIPLEYDGPTTVSFVAWANPDDHMLEETANVQNVKDLFFRLSSTDGIAQSPGDLFSGVLTCPIEYGSIEQGTDQTVDIYRRTAQVHIIIRGYQEWLEANGPRQLPDYADILLGETPDTYTGLAELIGNAVQYRPDGQIQNGDFISPIIRVYPTLDTTPLHLKLYAYGQELLNISTGSDGVPFIPVIGKMLNIYIDLRGANLNVLVSVTPWDVVQQYAEY

33.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fimB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here