Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation (By similarity).

Belongs to the MIF4GD family.

222 amino acids

MGEASRDEYKIQSFDAETQQLLKTALKDPGAVDLERVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFQLAQPESLSREEEVDCLVLQLHRVGEQLEKMNGQRMDELFILIRDGFLLPIDLSSLARLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

25.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mif4gd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here