Description
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity).
Family
Belongs to the MICOS complex subunit Mic60 family.
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Sequence
MLRAGLRSSRALGLRPNVVSPGRQWRAQNARVISDTMRTFADKSSISDSRPPVLPGSASEATSEPLPPGAVATPNSAAPTPATPTSSTIPAENVPLTPPPPGVQSPGPPPPSSSPPPPAPKPKRRFFRKFFTTLFLLTTLGFGGGVYYSRINDNFHDFFTEYVPFGEDAVLYFEEQEFRKRFPLISSRASRPPRDTGEQVKIPSQSGVSWRVANENKDSTGRHTSSAKDKVKPSEAVQTPHDSKPADRVKAVEQVKSGNSPVKNSPAPPATPESKPSNVQKDPEVNEPSRAYKKIERIDPINIPNGNEPVVQELVKIMNDIIAVVNADNANARFTSTMDKAKAELNRVGAKILDMKDAALKQADEKIKSSDAEFDRAAMQLMQNFKNQQAEQEAQFRAEYEAERKRIHENYEQKLKSELDRANEVNEKTLQNNLTEQALELKRAFLADVKNRVEQEREGRLGKLSELTSTVNDLEKLTGDFNTVVDQNLKTQHLHVAVEAVRANLEKSQIPRPFTRELAALKEIASDDPVVNAAIASINPVAYQKGVPSSAALIDRFRRVASEVRKASLLPEEAGVASHASSYVLSKLLFKKKGLATGDDVESILTRTETFLEEGDLDGAAREMNGLKGWAKTLSKDWLGEVRKVLEVQQALDKPDYKV
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service