About Products Protein Database Contact

Protein expression services for mic60 | MICOS complex subunit mic60

Description
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway (By similarity).
Family
Belongs to the MICOS complex subunit Mic60 family.
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Length
659 amino acids
Sequence
MLRAGLRSSRALGLRPNVVSPGRQWRAQNARVISDTMRTFADKSSISDSRPPVLPGSASEATSEPLPPGAVATPNSAAPTPATPTSSTIPAENVPLTPPPPGVQSPGPPPPSSSPPPPAPKPKRRFFRKFFTTLFLLTTLGFGGGVYYSRINDNFHDFFTEYVPFGEDAVLYFEEQEFRKRFPLISSRASRPPRDTGEQVKIPSQSGVSWRVANENKDSTGRHTSSAKDKVKPSEAVQTPHDSKPADRVKAVEQVKSGNSPVKNSPAPPATPESKPSNVQKDPEVNEPSRAYKKIERIDPINIPNGNEPVVQELVKIMNDIIAVVNADNANARFTSTMDKAKAELNRVGAKILDMKDAALKQADEKIKSSDAEFDRAAMQLMQNFKNQQAEQEAQFRAEYEAERKRIHENYEQKLKSELDRANEVNEKTLQNNLTEQALELKRAFLADVKNRVEQEREGRLGKLSELTSTVNDLEKLTGDFNTVVDQNLKTQHLHVAVEAVRANLEKSQIPRPFTRELAALKEIASDDPVVNAAIASINPVAYQKGVPSSAALIDRFRRVASEVRKASLLPEEAGVASHASSYVLSKLLFKKKGLATGDDVESILTRTETFLEEGDLDGAAREMNGLKGWAKTLSKDWLGEVRKVLEVQQALDKPDYKV
Mass
72.6 kDa
Simulated SDS-PAGE
Western blot of mic60 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mic60 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here