About Products Protein Database Contact

Protein expression services for MADS58 | MADS-box transcription factor 58

Description
Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3.
Species
Oryza sativa subsp. japonica
Length
272 amino acids
Sequence
MHIYKEQEAEPSTGLMMPEPAPVASPGSGGSGGSGSVGAEKIGSRGKIEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSNNSVKETIERYKKANSDTSNASTVAEINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRARKNELLCAEIEYMQRRETELQNDNMYLKSKVAESERGLQTVNMMGSASTSEYVQNMIHYDPRNFLQFNIMHQPQYYPEQEDRKAFMSDER
Mass
30.8 kDa
Simulated SDS-PAGE
Western blot of MADS58 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MADS58 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here