Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time.

164 amino acids

MARRGRVQLRRIEDKASRQVRFSKRRAGLFKKAFELALLCDVEVALLVFSPVGKLYEYSSSSIEGTYDRYQQFAGARRDLNEGSTSINSDENASIHSRLRDITAWSLQNNADESDANQLEKLEKLLTNALRDTKSKKMLAKQNGEGSRSRANSSGSRGQEEGSA

18.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MADS51 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here