Enzyme catalyzing the degradation of lysoplasmalogen. Lysoplasmalogens are formed by the hydrolysis of the abundant membrane glycerophospholipids plasmalogens. May control the respective levels of plasmalogens and lysoplasmalogens in cells and modulate cell membrane properties.

Belongs to the TMEM86 family.

224 amino acids

MDARKEGLLRKPRFSAQPRVGMGLLPFFLACAVYLLVRNADQPPWVNVLLKILPVLYLAGFLGTAHPGGGYRALLQGALLCSAVGDACLVWPEALRYGMAAFGLAHLLYLRAFGLTPLKPGLLLPLLLVSALYFRVLHPHMPPQVVWPLLAYSIVLVAMLWRGLARGGSAHWGALLFVLSDSVLAWNIFTYLVPHGHLLVMTTYYSAQMLITLSAFQNPRLKSH

24.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TMEM86B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here