Histone demethylase required for G2/M phase cell cycle progression (By similarity). Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator (By similarity). May play a role in the regulation of the circadian clock (By similarity).

406 amino acids

MASVWTDIRAVLPSTVSEFPLDFSEKIDLSVLKCLELSRDQLYSEADCPVSAERAQIIIDYSWEKLNIGTWRDVDKEWRRVYSYGCLFKVLSLCHGNPPQNIIQEAVRTCDMSLLMGAAIMDNILQRLVGILRNKIKTTCPNKAERSEEPFSKKRKHDCKSEPVLNPTKEVPRIHCPSLERFRSDFLDPKKPVIIEGITDLWPAFTQHPWSIDYLRTVAGCRTVPIEVGSKYTDEEWSQKLITVNDFIDRYITGTEEDGVGYLAQHQLFDQVPELKEDIRIPDYCCLGEGDEDDITINAWFGPGGTVSPLHQDPQQNFLAQVVGRKYIRLYSPEDTKSLYPHESQLLHNTSQVEVENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWYYVRSLELSFSVSFWWS

46.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make kdm8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here