Might have a role in sequestration of chitin oligosaccharides (breakdown products of fungal cell walls that are released during invasion and act as triggers of host immunity) to dampen host defense.

458 amino acids

MVSLKVCFLLLASSELAFGAAPGARSRRRGTAPANPYDKDTTSYCTWWLDYNEELPCDQVLQANSITLEKFRRWVSGGQSNTPINQWENHKANHKAKNPSITGNCEGMTVGKSYCVEAAFEPTPTASPTGPSGPTGTPGTIETPLPTQPEIAPNCDAFHLVKQGEDCGTISATYGITSAQFLAWNPSAGKDCTGLWANAYACVSIVGHEPPKTTSQAPQPTPTKPSNGIETPLPTQPKIVDNCDKFHLVQSGEGCAAITSKYGISLAQFTQWNPAAGSNCEGLWANAYACVSIIGHEPMPTPTKPSNGIETPLPTQPEIVDNCNKFYLVQSGDTCTTIVSKYGITLSDFTKWNPKAGNTCAGLWANAYSCVSIIGYTPKPSPTPTPTKPPNGIQTPTPIQNGMVTNCNKFHFVENGNTCPVIQAKYKVTLADLVRWNPAIKADCTGLWAKTYLCVGTL

49 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARB_05157 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here