Catalyzes the NADPH-dependent reduction of L-xylulose, D-xylulose, L-(+) erythrulose, D-erythrose, D-threose, L-ribulose, 1,4-dibromo-2,3-butanedione and 2,3-heptanedione (PubMed:21477590). Also active against isatin, 9,10-phenanthrenequinone, menadione, 2,3-hexaenadione and 3,4-hexahenadione (PubMed:21300042). No activity observed when tested using NADH rather than NADPH (PubMed:21300042).

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

251 amino acids

MPANYDFTDKRILVTGASQGIGKEICLSLAKAGAQVIAFARNEANLLSLVKETTSLRYTIIPIVGDVSANEEVLFKLIVPHFPIHGLVNNAGIATNHAIGQITQQSIDRTFAVNVRGPILIAQLVARNFVDRQIKGSIVNISSQAAIRPLDNHTVYCASKAALDMVTRCLANELGSQNIRVNSVNPTVVMTDMGRDNWSDPDKKKKMLDRMPIKRFAEVDEVVNAVLFLLSDNASMTTGSTLPVDGGFSNN

27.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dhs-21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here