Hexosyltransferase involved in N-glycan biosynthetic pathway that takes place under low-salt conditions (1.75 M instead of 3.4 M). Participates in the formation of the tetrasaccharide present at 'Asn-532' of S-layer glycoprotein Csg, consisting of a sulfated hexose, 2 hexoses and rhamnose. Together with Agl6, mediates the addition of sugars 1 and 2 to dolichol phosphate in the tetrasaccharide.

Belongs to the glycosyltransferase group 1 family.

372 amino acids

MGQDSGGLPHYTAELANSMSEYARVTVLKPNETSADEVLRDEITVINAFKPTDISMQNLFDLKLDVLDSIRGLFSFWNIKLINQIDPDIVHDPTDEFPQVNLFSWVHSVYEDRPYVVTSHETKHGGAGGVLRVVNPLLSLVPDFEKSAAIVHSADQRELLLNNHKAVDEVHVIPHGVYSFFRELDYDEQKEEDKHALFFGSLIPPKGIEYLIDAVPKVSEEVPGFSLTIAGSGSIPDECADVVEQYSDVINIRNEFIPNEEVGTLFSRAQVVVLPYRRGWQTGHSGTLSIAFAFGKPIITSEVGDFPELVGESGAGIVVEPESPEAIADGLIEVFSSDSALDQMSNASSRVADRLSWEKIAEQHFEVYQNLL

41.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make agl5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here