Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes.

Belongs to the WD repeat LIS1/nudF family.

403 amino acids

MVLTARQRDELNQAIHQYLLISYQQSAQLFKTEAAVKDGQIEADLLEKKWNSIVRLSKRVITLEQQVEQLNEQLAQAQAGKIQFNKSDDEQRLTPIEKFKLEGHRAGVNCVAFHPQYQILGSASDDGSIKLWDYESGHFEKTLKGHTSNVNCLAFDPTGKYICSASSDLSIKIWELKNHTCVKTLIGHEHSVSTVQFSDHGDFILSASRDKNIKLWEVATGFCKKTFSEHQEWVRCAVFSNDEKQIASCSQDQMIYIWVIDSGQVLHQLSGHEHVVEQVKYIPEHGAKQILTQQQQQNIQTINLLVSVSRDKEIKIWNTILGTNLFTLSGHDNWVNGVSFHPDGVHMLSVSDDKTIRVWNLKEQKQKKKIENAHDKFILKCEINKFIFATCSVDQTIKLWLLS

46.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GSPATT00015130001 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here