Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

314 amino acids

MPKGRPSWFKVPAPSQGTQSTYSTASYSRYAQVKDSLQKLDLHTVCEEAQCPNIGECWNGGTGTIMLLGDTCTRGCMFCAVNTDSKPPPPDPFEPFKTAEAVVAWGVDYIVLTSVDRDDIADGGAQHFAQTVQLLKQNKPNLLVECLVSDFQGMLDSVETLALSGLDVYAHNVETVERLQPFVRDARANYQQSLSTLQHAKVVKPELYTKTSIMLGLGETEEEVTQTMTDLRAIGVDVVTFGQYLRPTEHHLSVVEYVTPEKFDHYRQVGENMGFKYVASGPMVRSSYKAGEFYLEHMIKKERTEAAIDIGENA

34.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PHATRDRAFT_28652 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here