An outer membrane protein that may participate in pathogenesis. Some human Lyme disease patients have antibodies against this protein (PubMed:10948116). The Mlp proteins probably undergo intragenic recombination, generating new alleles (Probable).

Belongs to the Multicopy lipoprotein (Mlp) family.

148 amino acids

MKIINILFCLFLLLLNSCNSNDNDTLKNNAQQTKSRGKRDLTQKEATPEKPKSKEELLREKLSEDQKTHLDWLKEALGNDGEFDKFLGYDESKIKTALDHIKSELDKCNGNDADQQKTTFKQTVQGALSGGIDGFGSNNAVTTCGNGS

16.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mlpA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here