About Products Protein Database Contact

Protein expression services for pagP | Lipid A palmitoyltransferase PagP

Description
Transfers a palmitate residue from the sn-1 position of a phospholipid to the N-linked hydroxymyristate on the proximal unit of lipid A or its precursors. Required for resistance to antibody-mediated complement lysis. Modifications of lipid A with a palmitate chain allow to evade host immune defenses by resisting antibody-mediated complement lysis during respiratory infection.
Family
Belongs to the lipid A palmitoyltransferase family.
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Length
182 amino acids
Sequence
MTQYFRALAFFLLLVPATAMACDGWPSWARGACQRVDQIWNEGGNDLYLTGYSWHNRAMYSSDKIRSFNELAWGGGLGKSIYDEDGDWQGLYAMAFLDSHSDIEPIAGYGFQKIGRIGADTRLGIGYTVFLTSRSDIMSRVPFPGILPLVSAGYRDATLYATYIPGGKGNGNVLFMFGRWEF
Mass
20.3 kDa
Simulated SDS-PAGE
Western blot of pagP recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make pagP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here