About Products Protein Database Contact

Protein expression services for pagP | Lipid A palmitoyltransferase PagP

Description
Transfers a palmitate residue from the sn-1 position of a phospholipid to the N-linked hydroxymyristate on the proximal unit of lipid A or its precursors (By similarity). Confers resistance to cationic antimicrobial peptides (CAMPs). Promotes the ability of L.pneumophila to replicate and/or survive in macrophages. Important for ability to kill macrophages and to promote the virulence (PubMed:11401964).
Family
Belongs to the lipid A palmitoyltransferase family.
Species
Legionella pneumophila
Length
186 amino acids
Sequence
MKRLISCLTIICALNRSAAAETTSSPCSRWISLLKPVCQRIHQTWTEGHDDMYFSGYAWHNRYTYRPEKIKSYNEAAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHIEPAVGYAYLKTASVNKDIKAGLGYSVLVTSRVDYDNVPFPGALPWVALFYKRTTVAATYIPGSAGAGNVLYILGKISL
Mass
20.7 kDa
Simulated SDS-PAGE
Western blot of pagP recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make pagP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here