In the final step of gramicidin biosynthesis, reduces the pentadecapeptide-aldehyde intermediate, that is released from the terminal module of the non-ribosomal peptide synthetase LgrD, to the final product ethanolamine-containing gramicidin.

Belongs to the thioesterase family.

263 amino acids

MQKTHVSPSRWLLSPKMTAEAEVLLFSFHYAGGHAGIYREWQKKLPVQIGVCPVQLPGRSNRFMEPYYTDLSVMIRELAEALLPHLNRPFAFFGHSMGALVSFELARYLRNQYGIKPRHMFASGRHAPHLPDPGEAIHHLPDAEFLKGLRTLNGTPKELFENEENEEILQMLLPMLRADFTICEQYQYQEEEPLGCGLTAIGGWQDPDITVAHMEAWRKHTSASFQMHMLQGDHFFLHSEQEQLLAIIESTLQSYLVGYRGIG

30.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lgrE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here