Synthesizes chlorophyll f or chlorophyllide f (Chl f, 2-formyl chlorophyll a), probably by oxidation of chlorophyll a or chlorophyllide a and reduction of plastoquinone. The reaction is probably light-dependent (PubMed:27386923). Chl f absorbs far red light (FRL, 707 nm in 100% methanol), and is synthesized when cells are grown in FRL, where it provides the advantage of extending the spectral range of harvested light in terrestrial cyanobacteria (PubMed:27386923). When ectopically expressed in Synechococcus PCC 7002 (which does not grow in FRL and does not make Chl f) produces Chl f (0.059% of total chlorophyll) (PubMed:27386923).

Belongs to the reaction center PufL/M/PsbA/D family.

376 amino acids

MKLESDHVIATSDSSDYTSEPTANKLSKRRKKVNYWEKFCSWVTSTENRLYVGWFGVLMIPCVLTAATVFIIAIIAAPPVDMDGIGVPISGSILSGNNIITAAVVPTSAAIGLHFYPIWEAASIDEWLYNGGPYQLIVLHFLIGIIAYQDREWELSYRLGMRPWISLAFTAPVAASVSVLLIYPVGQGSLSAGMPLGISGTFHFMLQFQADHNILMSPLHQLGVIGVLGGAFAAAMHGSLVTSTLIRSHNHSESESINKGYKLGQQHPTYNFRSAQVYLWHLIWQRVSFPNSRKLHFFLAALPVAGIWSAALGVDIAAFDFDYLQFHQPELKSQGQIIHTWADTIDWASLGIKVLDERHIYDFPENLTAGEVVPWK

41.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chlF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here