Involved in the biosynthesis of the coenzyme F420 which requires phospholactate produced via the aldol cleavage of L-fuculose 1-phosphate and the NAD(+)-dependent oxidation of (S)-lactaldehyde (PubMed:16585745). Catalyzes the reversible cleavage of L-fuculose 1-phosphate (Fuc1P) to yield dihydroxyacetone phosphate (DHAP) and S-lactaldehyde (Ref.2, PubMed:16585745, PubMed:17927915, PubMed:22418259). FucA possesses a high specificity for the dihydroxyacetone phosphate (DHAP), but accepts a great variety of different aldehydes such as DL-glyceraldehyde and glycolaldehyde (PubMed:16585745, PubMed:17927915).

Belongs to the aldolase class II family. AraD/FucA subfamily.

181 amino acids

MDKKQFIKICRKLYDRKYVVGSGGNVSVKEGDKIYLTPTGSILGFLKEDDIAEMDLDGNVIKGKPTSEKNLHLMIYRKRNDINAIIHTHSLISTFLSTINKEIELLTPEGKIFLKKIGYVDYYEAGSLKLAEETAKRDEDVIILKNHGVVCLGKDLIDAYIKVEVLEEQAKLTLLNLLVKK

20.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fucA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here