Protein expression services for fucA | L-fuculose phosphate aldolase
Description
Involved in the biosynthesis of the coenzyme F420 which requires phospholactate produced via the aldol cleavage of L-fuculose 1-phosphate and the NAD(+)-dependent oxidation of (S)-lactaldehyde. Catalyzes the reversible cleavage of L-fuculose 1-phosphate (Fuc1P) to yield dihydroxyacetone phosphate (DHAP) and S-lactaldehyde.
Family
Belongs to the aldolase class II family. AraD/FucA subfamily.
Species
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Length
180 amino acids
Sequence
MDNLKEFIKICHYLYDRKYVVGSGGNVSIKKDNLIYVTPTDSLLGFINEEDIAVVDMDGNIIKGAPTSELYMHLNIYKKRNGVNAIVHTHSLYSTALPMADKEIKLLTPESRIFLKKIGYVDYFEARSMELANEVSKKDEDVIVLKNHGIVCVGKNLMDAYLKTEVMEEISQLNYIIHSL
Mass
20.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make fucA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here