Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair.

Belongs to the peptidase S24 family.

209 amino acids

MKPLTPRQQEVFDLIKSKIDETGMPPTRAEIAKELGFRSANAAEEHLKALARKQVIEMVPGASRGIRILVDNAANEEEAETGLPLIGRVAAGEPILAQEHVEAHYQVDPSMFRPQADFLLRVHGESMKNIGILDGDLLAVHKTQDVRNGQVVVARVEDDVTVKRLERKGSKVFLHAENEEFAPIEVDLAAQSLTIEGIAVGVIRNSTWM

23 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lexA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here