Required for full activity and modification of the LtxA leukotoxin. Involved in fatty acid modification of the protoxin at two internal lysine residues, thereby converting it to the active toxin.

Belongs to the RTX toxin acyltransferase family.

168 amino acids

MEKNNNFEMLGYVAWLWANSPLHRNWSLSLLAINVLPAIQYGQYTLLMRDGVPIAFCSWANLSLENEIKYLEDVSSLVYDDWNSGDRKWFIDWIAPFGHNYVLYKHMRKSFPYDLFRSIRVYKGSSEGKITEFHGGKVDKQLANKIFQQYHFELINELKNKSEVISIN

19.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ltxC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here