Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization (By similarity).

Belongs to the chondromodulin-1 family.

334 amino acids

MTENSDKVPITMVGPEDVEFCSPPAYATVTVKPSGSPTRLLKVGAVVLISGAVLLLFGAIGAFYFWKGNDNHIYNVHYTMSINGRLQDASMEIDAANNLETFKMGSGAEEAIEVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVSTGTKQSISELEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKILEFCGDLPIFWLKPMYPKEIPRERREVVRSSAPSTTRRPHSEPRGNAGPGRLSNRTRPSVQDDEEPFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVVMPCSWWVARILGMV

37.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Cnmd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here