Protein expression services for AAEL010172 | Leucokinins
Description
Stimulates both fluid secretion by the Malpighian tubules and hindgut contractions. Depolarize the transepithelial voltage of the Malpighian tubules in concentrations of less than 10(-9) M and increase the frequency of hindgut contractions at concentrations above 10(-8) M.
Species
Aedes aegypti
Length
228 amino acids
Sequence
MAMLLQVALPLLAAVSWGWELNENDDSLAKIIEGCEWTSRQNVISEILLDRYRKYAMYNFFLLDDVCAVHEWNKNLKEPEFSENNEAEDKSPTSAQNTQEHIPGNNFPPPAASNPPVNSSCAKSAKDFFICLSNQLGDPTLNAMLLDNLEVACDPRFSPVSAIQKRNSKYVSKQKFYSWGGKRNNPNVFYPWGGKRNTGRVHRQPKVVIRNPFHAWGGKRNQKDDNVF
Mass
25.9 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AAEL010172 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here