Participates to viral hemadsorption, which may help viral spread. Reduces the transactivating activity of host TP53, thus inhibiting apoptosis (By similarity). Non-essential for virus growth in swine macrophage cell cultures (By similarity).

Belongs to the asfivirus lectin-like protein family.

158 amino acids

MFLNKKYPSLIEKKMDDLMTLKFCYLIITFLIITNIFSLAINIWGGGDMIDRQSCENIFYCPKDWVGYNNACYYFSNNNKNYTDANNYCKNSHNSTLANNDTKLLNLTKLLNLSKLYYNDSTYWVKYSLPKNKAVTLRNSTYKYDRVKYTETFFICSN

18.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ken-069 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here