Has immunoglobulin-binding and hemagglutination properties, and can bind to mannose. Essential for virulence. May be involved in LPS biosynthesis or polysaccharide transport (By similarity).

Belongs to the BA14k family.

147 amino acids

MNSFRKTCAGALALIFGATSIVPTVAAPMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLAAFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYSR

16.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BOV_A0688 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here