Part of the ABC transporter complex TcyJKLMN involved in L-cystine import. Probably responsible for the translocation of the substrate across the membrane (Probable). Is also involved in cystathionine, djenkolate, and S-methylcysteine transport.

Belongs to the binding-protein-dependent transport system permease family.

239 amino acids

MEKAFDMNMIGDFVPTLTAYLPVTLYILTLSLLFGFVLGLFLALPRIYNIPIVNQLAKVYISFFRGTPIMVQLFIVFYGIPALTGLIGIDTSKMDPFYAAVATYALSNAAAAAEIIRAGVGSVDKGQTEAAYSIGLSGSQAFRRIVLPQALVQAFPNMGNMVISSLKDTSLAFSIGVMDMSGRGQTLITSSNHSLEVYIALSIVYYAVAVLFEWFFRVAEKRIKKNQTRIVTVFDMNIH

26.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tcyL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here