Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover (By similarity).

Belongs to the lariat debranching enzyme family.

478 amino acids

MSYFARLKPPPAFLKMRVGVQGCCHGILDNLYILAEKRKVDLLIIGGDFQALRNVSDYHGISMPPKFKRLGDFFNYYNGRNKAPILTIFVGGNHEASNYLDELPYGGWVAPNIYYMGRSSVINVGGLRIAGISGIYSAMDYKKGRYEGLPYNYKMLKSIYHTREFDVLSLKSLQKPIDIFLSHDWPRGIEQHGDVAKLLRHKPFFRNEVERNDLGSPALEELLVELKPRYWMAAHLHTKFTAVVHHNSQEDDGKLSCSSKDVTSSGFSMKGLNEPSQERLPVEKEQNDKSDEEGSNNEQEEKQDKKQSTNRDLCRKESCKKEPSLSSSDQVTKFLALDKCLPRRSYFEVVEIEPVEIPDSGAPYMQYDSEWLSVLRAMHPFQSHTIEQDPPLPSLEVVKTLKRKEEIWVDENLVKKDKLGIPRNFCQTAPPHSRDITENMQPSSYINPQTVAFEILIGLKERTVDSPPPVKNPNEIVL

54.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dbr1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here