Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.

Belongs to the MscL family.

148 amino acids

MSMVKEFKEFALKGNVMDLAVGVIIGGAFSTIVNSIVKDLIMPVVGLATGGLDFSNKFVRLGPIPPTFKGSPESYKDLQTAGVAVFGYGSFITVLINFLILAFIIFLMVKFINNLRKPAEAAPAAPPPPPEDVLLLREIRDSLKNSPR

16 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mscL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here