Protein expression services for A4galt | Lactosylceramide 4-alpha-galactosyltransferase
Description
Catalyzes the transfer of galactose from UDP-alpha-D-galactose to lactosylceramide/beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide(d18:1(4E)) to produce globotriaosylceramide/globoside Gb3Cer (d18:1(4E)) (PubMed:10854428). Also able to transfer galactose to galactosylceramide/beta-D-Gal-(1<->1')-Cer (By similarity). Globoside Gb3Cer is a glycosphingolipid of the globo serie, one of the major types of neutral root structures of glycosphingolipids, that constitute a significant portion of mammalian cell membranes (By similarity).
Family
Belongs to the glycosyltransferase 32 family.
Species
Rattus norvegicus
Length
360 amino acids
Sequence
MGISRSDLEETMSKPPDCLPRMLRGTPRQRVFTLFIISFKFTFLVSILIYWHTVGAPKDQRRQYSLPVDFPCPQLAFPRVSAPGNIFFLETSDRTNPSFLFMCSVESAARAHPESQVVVLMKGLPRDTTAWPRNLGISLLSCFPNVQIRPLDLQELFEDTPLAAWYLEAQHRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNMLGIQSRYVLNGAFLAFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWQNWKKYFEDVSPEELAQLLNATYAVHVWNKKSQGTHLEATSRALLAQLHARYCPTTHRAMTMYL
Mass
41.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make A4galt using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here