Acts as a positive cofactor of GATA transcription factors to establish the identity of the ventral mesoderm during gastrulation. Down-regulation in the dorsal mesoderm is necessary for the proper formation of this territory since, when present, lmo4 may bind ldb1 and restrict the availability of this cofactor for Spemman organizer transcription factors. At neurula stages, suppresses primary neuron differentiation and modulates gene expression at the Isthmic Organizer of the midbrain-hindbrain boundary.

171 amino acids

MVNNRSSESTTTAVSSNGSPPKACAGCGGKIGDRFLLYSMDRYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGNSGACNACGQSIPASEMVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGTIFCEHDRPTGLLNGHLNPLQSNPLQGSPMLPDQKVC

18.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lmo4-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here