Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity).

Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.

435 amino acids

MLRNTVKRLMTYTFKPSKQTSSFGPSVWLEFSPLAIKYNAVNLGQGFPNFEPPKFVKDAMIKTIEVGGFNQYTRSPGHIRLVKALSSVYSPYFGRELNAMTEIMVGVGASESLFAAISSIVNEGDEVILIEPFFDIYIGPILMAGGIPKFVTLKEEESSQAGSSDKKRSSKHWKINKEELAAAFTDKTKLIILNNPHNPVGKVYSKEELQEIADVVAKHGPNTTVISDEVYEWMTFDGEEHHRFATLPGMWERTITIGSAGKTFSITGWKVGWCIGPSNIIGAIANTHQYVPFSVPTPTQEAVAIALEQPNIKDYFKELATMYQNKRDTLLNSLTQAGLDPVIPQGTYFIMGDTSSIHLQGDQGKDTSITGMGLHLRDWNIARYLTTEYGVTTIPPSAFYCDDHQKIPENFVRFTFCKDDLTLQKAHDNLLKLKK

48.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ccbl using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here