Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation.

Belongs to the Cyclase 1 superfamily. KynB family.

212 amino acids

MPTLWDITPAVDTATPVWPGDTPVGIERVWRMEAGSPVNVARLTLSPHTGAHTDAPLHYDAEGVAIGEVPLDAYLGRCRVIHCIGASPVVTPQHLSGSLDDLPPRVLLRTYRNAPTAAWDSAFCAVAPDTIDLLAARGVKLIGIDTPSLDPQESKTMDAHHRIRTHRMAILEGIVLDDVAPGDYELIALPLKLTTLDASPVRAILRALPESQ

22.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make kynB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here