Description
As part of a BORC-like complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, this complex may couple lysosomes to microtubule plus-end-directed kinesin motor. May also be involved in the biogenesis of lysosome-related organelles such as melanosomes.
Family
Belongs to the KXD1 family.
Sequence
MAEQVTEATASGVFCSRILNMVNTGDVNAIILAQRHMLDRFEKTNEMLLNFNGLSNVRLQQMSDRFAHHTRTLVEMKKDLDIIFRRIRMLKGKLAKQYPESFNNVHESPILEDDDDFDPTLKSAATTIATSEQSTESCDTSPSIISPAMSQDFEDLSQAPSDTPSVNGQILTDEELVHED
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service