Description
Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Regulates the circadian expression of genes involved in lipogenesis, gluconeogenesis, and glycolysis in the liver. Represses the expression of PCK2, a rate-limiting step enzyme of gluconeogenesis. May play a role in the cell cycle regulation (By similarity). Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcriptional activity.
Family
Belongs to the Sp1 C2H2-type zinc-finger protein family.
Sequence
MLNFGASLQQASEGKMELISEKSKEGAHPWDKAEQSDFEAVEALMSMSCDWKSHFKKYLENRPVTPVSDTSEEDSLLPGTPDLQTVPAFCLTPPYSPSDFEPSQGSNLTAPAPPTGHFRSLSDAAKPPSIAPFKEEEKSPLAAPPLPKAQATSVIRHTADAQLCNHQSCPVKAASILNYQDNSFRRRTHINVEATRKNIPCAAVSPNRPKPEPSTAANGAEKAGTAPYDFAVPSSETVICRSSQPAPTSPVQKSVLMSSPTVSTGGVPPLPVICQMVPLPANNSLVTTVVPSSPPSQPPAVCSPVLFMGTQVPKGTVMFVVPQPVVQSPKPPVVSPNGTRLSPIAPAPGFSPSAARVTPQIDSSRVRSHICSHPGCGKTYFKSSHLKAHVRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPATASAQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service