Specifically blocks the catalytic activity of the chorismate mutase Cmu1 from the fungal pathogen Ustilago maydis. Hinders substrate access to the active site of Cmu1 through intimate interactions (PubMed:30651637). A structural feature specific to the fungal secreted Cmu1 called extensive loop region (ELR) is required for the intimate interaction (PubMed:30651637). Does not interact with its own chorismate mutases (PubMed:30651637). The secreted fungal Cmu1 presumably affects biosynthesis of the plant immune signal salicylic acid by channelling chorismate into the phenylpropanoid pathway (PubMed:30651637).

Belongs to the kiwellin family.

198 amino acids

MATVGGNRALYAVVALPLLATLLHGPMRLSHAFPYRSLLQTCQPSGSIQGRSGNCNTENGSECCKNGRRYTTYGCSPPVTGSTRAVLTLNSFAEGGDGGGAAACTGKFYDDSKKVVALSTGWYNGGSRCRKHIMIHAGNGNSVSALVVDECDSTVGCDKDHNFEPPCRNNIVDGSPAVWDALGLNKDDGQAQITWSDE

20.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make KWL1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here