Has a role in hair formation. Specific component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle (By similarity).

Belongs to the intermediate filament family.

553 amino acids

MNRQFTCKSGAANRGFSGCSAVLSGGSASSYRAGGKGLGGGFSSRSLYSLRSPRSISFNVASGSGRTGGYGFGRNRASGFAGSMFGGGALGPSNPSLCLPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLQTKWELLQQLDLSNCRRNLEPVYEAHISSLQKQLDSLSGDRVRLDSELRGMRDAVEDCKKRYEEEINKRTTAENEFVVLKKDVDAAYMSKVELQAKVDALDGEIKFLKCLYEGEITQMQSHISDTSVVLSMDNNRNLDLDSIIAEVRAQYEDIALKSKAEAEMVYQTKFQELQLAAGRHGDDLKHTRNEISELTRLIQRLRSEIESVKKQCSNLETAIADAEQRGDCALKDAQAKLDDLERALHQAKEELARMLREHQELMSMKLALDIEIATYRKLLEGEECRMSGEHTNAVSISVISSSTTGAVGAGTSFGFSNPSTYGYRPSSVAGGYGILSGGCVTGSGNCSPRGDTKTRLGSASEFKEVSGKTLALGSPSKKTMRADRQSSISVQLWFS

60.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Krt73 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here