Description
Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Binds to RNA. Required for female germline development, cell viability during eye development and for survival of dividing cells and epithelial cells during early wing disk development (By similarity).
Family
Belongs to the KRR1 family.
Sequence
MSESEAEETKISTEPVDNAWAMKIPTFRQEDNPHGVVEESSFATLFPKYRERYLKEVWPLVEQCLSEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETMNNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQGRTEKQKEAAKRQDERRNKDFVPPTEESAASSRKKEDGSSTKVDVKALKAKLIKANKKAKSS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing dbe in a
cell-free protein expression systems? We have solved
cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.
Order Here