Description
As part of the KICSTOR complex functions in the amino acid-sensing branch of the TORC1 signaling pathway. Recruits, in an amino acid-independent manner, the GATOR1 complex to the lysosomal membranes and allows its interaction with GATOR2 and the RAG GTPases. Functions upstream of the RAG GTPases and is required to negatively regulate mTORC1 signaling in absence of amino acids. In absence of the KICSTOR complex mTORC1 is constitutively localized to the lysosome and activated. The KICSTOR complex is also probably involved in the regulation of mTORC1 by glucose.
Sequence
MRSVSYVQRVALDFSGSLFPHAICLGDVDNDALNELVVGDTSGKLSVYKNDDSRPWLTCMCQGMLTCVGVGDVCNKGKNLVVAVSAEGWLHLFDLTPTKALDASGHHETLGEEQRPVFKQHIPANTKVMLISDIDGDGCYELVVGYTDRVVRAFRWEELAEGPEHLAGQLVSLKKWMLEGQVDSLSVTPGPLGVPELVVSQPGCAYAVLLCTWNKDTGSPPASEEATGDSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIRQGHNPEGGNAGLFALCTLDGTLKLMQEADKLLWSVQVDHQLFALEKLDVTGNGLEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGQYACKEGRNSPCLVYVTFNQKIYVYWEVQLERMESTNLLKLLEAEPEYHRLLQELRVDPEDLPAVCTLLHQTLYHPDQPLQCTPSSFQDPT
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service