Description
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
Sequence
MKKAFLLACVFFLTGGGVSHAAVQKTIFSADVVASVCHVVVDADSTGNSGRLTFGTYRKSTGASVPPRDFTVRLYESGATVQGCSAFLAGQVATLDFGNPGQLDAAGVVTRGAGDGIRVDVRAVDAQADYRGRLTQDNHSVKYPVDFAAKGQFRFRAQPVFPADVKAGEYSGALTFVVTYQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service