Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.

181 amino acids

MKKAFLLACVFFLTGGGVSHAAVQKTIFSADVVASVCHVVVDADSTGNSGRLTFGTYRKSTGASVPPRDFTVRLYESGATVQGCSAFLAGQVATLDFGNPGQLDAAGVVTRGAGDGIRVDVRAVDAQADYRGRLTQDNHSVKYPVDFAAKGQFRFRAQPVFPADVKAGEYSGALTFVVTYQ

19.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make faeC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here