Catalyzes the condensation of isopentenyl diphosphate (IPP) with allylic pyrophosphates generating different type of terpenoids.

Belongs to the UPP synthase family.

257 amino acids

MLNFIRSDKDKGKGNDNDINFSNIPKHIAIIMDGNGRWAKKRNLPRTMGHKAGGEALKRIVRECSDIGVKYLTVYGFSTENWIRPKEEVNAIMRLIVEFLKREFNELNKNNVIINPIGNILGLPEACITALNDAKNKTKNNTGLMLNLALNYGGRDEILNAVKNIFASYEENKISKDEIFNLSDEEFSSYLYTGCIPDPDIIIRPSGEKRLSNFLLWQCAYSEFWYSNINWPDFSIEDLHTAIKDYQNRDRRFGGVK

29.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make uppS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here