Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).

Belongs to the IPP isomerase type 1 family.

291 amino acids

MSTASLFSFPSFHLRSLLPSLSSSSSSSSSRFAPPRLSPIRSPAPRTQLSVRAFSAVTMTDSNDAGMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFSVFLFNSKYELLLQQRSKTKVTFPLVWTNTCCSHPLYRESELIEENVLGVRNAAQRKLFDELGIVAEDVPVDEFTPLGRMLYKAPSDGKWGEHEVDYLLFIVRDVKLQPNPDEVAEIKYVSREELKELVKKADAGDEAVKLSPWFRLVVDNFLMKWWDHVEKGTITEAADMKTIHKL

33.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make IPP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here