Description
Bifunctional enzyme which can phosphorylate or dephosphorylate isocitrate dehydrogenase (IDH) on a specific serine residue. This is a regulatory mechanism which enables bacteria to bypass the Krebs cycle via the glyoxylate shunt in response to the source of carbon. When bacteria are grown on glucose, IDH is fully active and unphosphorylated, but when grown on acetate or ethanol, the activity of IDH declines drastically concomitant with its phosphorylation.
Family
Belongs to the AceK family.
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Sequence
MVTKLEQLIAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDSHVGLVVEQLKHITDQRCFDVNFLTRVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVFSSQPERRFREIPRPLARDFAPKGDLSGMLQVVLNDLPLRLPWENLPRDIGYIATALRQNFTDEQLATARFQVANELFYRNKAAWLVGKLRLADEVYPFLLPIHHNESGGLFIDTCLTSKAEASIVFGFARSYFMVYAPLPAAMVEWLREILPGKSTAELYMAIGCQKHGKTESYREYLTFVHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKDQFAPQKEVSQTRVLECYQLVKEHDRVGRMADTQEYENFVIDKHRISAELLTELQREVPEKLEDLGDQIIIKHLYMERRMTPLNLYIEQANDQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEEFRHFLCTDLKVRHFFEEMHSDLFHASYWRGLQQRIKDGHVEDVFAYRRKQRFSQRVIS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service