Involved in the incorporation of salicylate into the siderophore pyochelin. Catalyzes the elimination of the enolpyruvyl side chain from isochorismate to yield salicylate and pyruvate via a rare pericyclic hydrogen transfer mechanism from C2 to C5. PchB also catalyzes the nonphysiological Claisen rearrangement of chorismate to prephenate in which the pyruvylenol tail is transferred from a C3 ether linkage to a C1-C9 linkage.

101 amino acids

MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRGAA

11.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pchB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here