About Products Protein Database Contact

Protein expression services for ATM1 | Iron-sulfur clusters transporter ATM1, mitochondrial

Description
Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. Hydrolyzes ATP. Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity).
Family
Belongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily.
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Length
691 amino acids
Sequence
MFRLLRFSPSRYYPRSMAPVRWSTHPYHVTAPRMWGTRMPLQLQASLRPNNAVEKGISGDVKVAGAMVKPAASGGESAKSKTPTVSELKILKDLFRYIWPRGDRKVKTRVLIALGLLLGSKLLNVQVPFFFKSTVDSMNIEWGDVGTALPIAVTLTVLSYGAARFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGCKGISYVLSAMVFHIIPITFEISMVCGILTYQFGASFAAITFSTMLLYSIFTFRTTAWRTRFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYDPERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVLEQGSVREEGTHSSLLASQGSLYRGLWDIQENLTLPERPEQSTGSQHA
Mass
76.8 kDa
Simulated SDS-PAGE
Western blot of ATM1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ATM1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here