Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. Hydrolyzes ATP. Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound (By similarity).

Belongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily.

691 amino acids

MFRLLRFSPSRYYPRSMAPVRWSTHPYHVTAPRMWGTRMPLQLQASLRPNNAVEKGISGDVKVAGAMVKPAASGGESAKSKTPTVSELKILKDLFRYIWPRGDRKVKTRVLIALGLLLGSKLLNVQVPFFFKSTVDSMNIEWGDVGTALPIAVTLTVLSYGAARFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGCKGISYVLSAMVFHIIPITFEISMVCGILTYQFGASFAAITFSTMLLYSIFTFRTTAWRTRFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYDPERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVLEQGSVREEGTHSSLLASQGSLYRGLWDIQENLTLPERPEQSTGSQHA

76.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ATM1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here